spacer
spacer
EBIDatabasesDatabase BrowsingDbfetch

EBI Dbfetch

ID   J01609; SV 1; linear; genomic DNA; STD; PRO; 1200 BP.
XX
AC   J01609; J01610; V00276;
XX
DT   12-DEC-1992 (Rel. 34, Created)
DT   06-MAR-2002 (Rel. 71, Last updated, Version 8)
XX
DE   Escherichia coli dihydrofolate reductase (folA) gene, complete cds.
XX
KW   dihydrofolate reductase; folA gene; reductase.
XX
OS   Escherichia coli
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
OC   Enterobacteriaceae; Escherichia.
XX
RN   [1]
RP   1-1200
RX   DOI; 10.1093/nar/8.10.2255
RX   PUBMED; 6159575.
RA   Smith D.R., Calvo J.M.;
RT   "Nucleotide sequence of the E coli gene coding for dihydrofolate
RT   reductase";
RL   Nucleic Acids Res. 8(10):2255-2274(1980).
XX
RN   [2]
RP   494-662
RX   PUBMED; 7047532.
RA   Smith D.R., Rood J.I., Bird P.I., Sneddon M.K., Calvo J.M., Morrison J.F.;
RT   "Amplification and modification of dihydrofolate reductase in Escherichia
RT   coli. Nucleotide sequence of fol genes from mutationally altered plasmids";
RL   J. Biol. Chem. 257(15):9043-9048(1982).
XX
RN   [3]
RP   494-662
RX   DOI; 10.1007/BF00384386
RX   PUBMED; 6761546.
RA   Smith D.R., Calvo J.M.;
RT   "Nucleotide sequence of dihydrofolate reductase genes from
RT   trimethoprim-resistant mutants of Escherichia coli. Evidence that
RT   dihydrofolate reductase interacts with another essential gene product";
RL   Mol. Gen. Genet. 187(1):72-78(1982).
XX
DR   GOA; P03819.
DR   InterPro; IPR016040; NAD(P)-bd.
DR   UniProtKB/Swiss-Prot; P03819; KEFC_ECOLI.
XX
CC   On Feb 26, 2002 this sequence version replaced gi:41478.
CC   [1] compared with PIR data.  [2] and [3] show nucleotide
CC   alterations in several mutant plasmids which lead to increased
CC   resistance to the antibiotic trimethoprim in E.coli.  [3] shows
CC   that their plasmids' increased resistance is due to either a
CC   mutation in the fol promoter (position 500; 'c' to 't'), which
CC   increases production of DHFR about 10-fold, or a mutation in the
CC   structural gene (position 618; 'c' to 't'), which changes a proline
CC   codon to a serine codon.  [2] and [3] show the fol promoter from
CC   positions 498 to 508 and 522 to 528.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1200
FT                   /organism="Escherichia coli"
FT                   /strain="K-12"
FT                   /mol_type="genomic DNA"
FT                   /note="strains RS16, RS35, RS50, RS58 & RS89 all substrains
FT                   of K-12 are described in Mol. Gen. Genet. 187, 72-78
FT                   (1982)."
FT                   /db_xref="taxon:562"
FT   mRNA            534..>1200
FT                   /gene="folA"
FT   CDS             558..1037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="GOA:P0ABQ4"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="PDB:7DFR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0ABQ4"
FT                   /protein_id="AAA87976.1"
FT                   /translation="MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRH
FT                   TWESIGRPLPGRKNIILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFL
FT                   PKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR"
XX
SQ   Sequence 1200 BP; 306 A; 288 C; 328 G; 278 T; 0 other;
     gtcgaccact acattcgttt gcgtcaggca ggcgttgaaa agccggagcg tgaaaccttc        60
     gaaggtgcgc tgaaaaccgg gcgtctggca ctggaaagtt taggtctggg gccgtatgaa       120
     gcgcgagaac gtgccgatgt gttccgccgc tttaatattc agatggtgga agagatggca       180
     atggttgaga acgacaccaa agcccgcgcg gcggtctata aacgcaccag cgcgatgtta       240
     agtgagatca ttaccgagga ccgcgaacat ctgtcattaa ttcaacgaca tggctggcag       300
     ggaaccgaag aaggtaaaca taccggcaac atggcggatg aaccggaaac gaaaccctca       360
     tcctaataaa gagtgacgta aatcacactt tacagctaac tgtttgtttt tgtttcattg       420
     taatgcggcg agtccaggga gagagcgtgg actcgccagc agaatataaa attttcctca       480
     acatcatcct cgcaccagtc gacgacggtt tacgctttac gtatagtggc gacaattttt       540
     tttatcggga aatctcaatg atcagtctga ttgcggcgtt agcggtagat cgcgttatcg       600
     gcatggaaaa cgccatgccg tggaacctgc ctgccgatct cgcctggttt aaacgcaaca       660
     ccttaaataa acccgtgatt atgggccgcc atacctggga atcaatcggt cgtccgttgc       720
     caggacgcaa aaatattatc ctcagcagtc aaccgggtac ggacgatcgc gtaacgtggg       780
     tgaagtcggt ggatgaagcc atcgcggcgt gtggtgacgt accagaaatc atggtgattg       840
     gcggcggtcg cgtttatgaa cagttcttgc caaaagcgca aaaactgtat ctgacgcata       900
     tcgacgcaga agtggaaggc gacacccatt tcccggatta cgagccggat gactgggaat       960
     cggtattcag cgaattccac gatgctgatg cgcagaactc tcacagctat tgctttgaga      1020
     ttctggagcg gcggtaattt tgtatagaat ttacggctag cgccggatgc gacgccggtc      1080
     gcgtcttatc cggccttcct atatcaggct gtgtttaaga cgccgccgct tcggccaaat      1140
     ccttatgccg gttcgacggc tggacaaaat actgtttatc ttcccagcgc aggcaggtta      1200
//
spacer
spacer